PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00008g00273.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family M-type_MADS
Protein Properties Length: 183aa    MW: 21052.3 Da    PI: 7.7995
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00008g00273.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF42.77e-141655241
                              ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE- CS
                    SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifs 41
                              +i++k+  ++t skR++ + KKA+EL +LC++e+a++if+
  Peaxi162Scf00008g00273.1 16 FIKDKRAEEITISKRQKALCKKANELAILCGVEIAIMIFA 55
                              79***********************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.7E-8166IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.329767IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.49E-17991IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-9929IPR002100Transcription factor, MADS-box
PfamPF003191.6E-131655IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-92944IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-94465IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MERKSSQIKK DVEIDFIKDK RAEEITISKR QKALCKKANE LAILCGVEIA IMIFAIGCQP  60
FLFGNPDVES VVDRFLKTKQ ENVSPSNCSM LFENASRYKR KEKTDKKKKK VKENDDKGKA  120
IEGNFIDCSS KLEELNQKIE KLEIYLSKEI DDLEFEIKSK DPNFVLEMNV ESSSTMPSNW  180
LSL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016457900.12e-55PREDICTED: agamous-like MADS-box protein AGL29
TrEMBLM1DEI35e-50M1DEI3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000877671e-49(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA22971258
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34440.13e-17AGAMOUS-like 29